7,399 Free Images of The Test

vehiclemilitaryaircraftscienceequipmentaviationjethealthmedicinelaboratory
PK TS Lev tram test vehicle 2019 5
passenger trainvehicle
SH-3H Sea King of HS-5 in flight over a Los Angeles-class submarine, circa 1985 (NNAM.2011.113.393)
militarysea
U.S. Sailors with Naval Mobile Construction Battalion (NMCB) 25 review procedures before testing the outside air quality during a simulated chemical attack during chemical, biological and radiological (CBR) team 140214-N-JP566-094
militarypeople
US Navy 070502-N-3271W-001 Special Warfare Boat Operator 2nd Class Nathan Reeve challenges a Thomas Jefferson High School student to a flutter kick test
groupiowa
US Navy 080812-N-9774H-084 Hospital Corpsman 3rd Class Richard Utley, a Navy augmentee working as an optometric technician embarked aboard the amphibious assault ship USS Kearsarge (LHD 3), uses a tono pen to test ocular pressu
united states navy images from puerto cabezasaboard uss kearsarge (lhd-3)
US Navy 060617-N-9851B-005 The counter measure wash down system aboard amphibious dock landing ship USS Tortuga (LSD 46) is tested to ensure its readiness on the ship's foc'sle
aboard uss tortuga (lsd-46)sea
US Navy 090507-N-6233C-099 Sailors validate the shipboard firefighting system during an Aqueous Film Forming Foam system test on the flight deck aboard of the aircraft carrier USS George Washington (CVN 73) to qualify the fligh
aqueous film forming foamwave
US Navy 090916-N-7280V-287 Fire Controlman Seaman Patrick Ramos and Fire Controlman 2nd Class Derek Hennen assigned to the amphibious command ship USS Blue Ridge (LCC 19) test-fire the Phalanx close-in weapons system or CIWS
fire controlmanpeople
US Navy 100425-N-9301W-095 Gas Turbine System Technician (Mechanical) 2nd Class Louie Reyes, front, and Gas Turbine System Technician (Electrical) 2nd Class Christian Djiofack conduct an emergency seawater cooling valve test
engine rooms of the united states navysouthern seas 2010
US Navy 070111-N-4515N-429 Guided missile destroyer USS Forest Sherman (DDG 98) test fires its five-inch gun on the bow of the ship during training
oceansea
US Navy 030701-N-0000X-001 The Los Angeles-class submarine USS Greenville (SSN 772) recently completed sea testing for the Advanced SEAL Delivery System (ASDS) off the coast of Pearl Harbor, Hawaii
watersea
A VSTOL F-35B on a test flight. (8270223178)
militaryvehicle
Clavical
sciencehealth
Coronavirus COVID-19 experiment
medicinescience
F-117A GBU-28
militaryvehicle
கீழா நெல்லி Botanical name - Phyllanthus niruri Common name – Stonebreaker Time tested Tamil Siddha medicinal plant is this ; Cures Jaundice; Lever- oriented diseases are also cured . S.Sou
natureplants
US Navy 030727-N-0696M-037 Lt. Steven Wyss gives the signal to launch an F-A-18F Super Hornet
militaryvehicle
US Navy 060308-N-0000X-003 A Standard Missile Three (SM-3) is launched from the Ticonderoga-class cruiser USS Lake Erie (CG 70) during a Missile Defense Agency, and Japan Defense Agency cooperative flight test mission
launches of rim-161 standard sm-3missile launches by night
US Navy 060308-N-0000X-001 A Standard Missile Three (SM-3) is launched from the Ticonderoga-class cruiser USS Lake Erie (CG 70) during a Missile Defense Agency, and Japan Defense Agency cooperative flight test mission
launches of rim-161 standard sm-3missile launches by night
US Navy 060528-N-3532C-028 Hospital Corpsman 2nd Class Ian Flemming-Dunn tests a local resident for tuberculosis aboard U.S. Military Sealift Command (MSC) hospital ship, USNS Mercy (T-AH 19) while visiting the city providing h
aboard usns mercy (t-ah-19)people
US Navy 070827-N-1805P-002 Naval Special Warfare-Navy Special Operations (NSW-NSO) recruit candidate Dan Shwartzel reaches for the wall during the 500-meter swim portion of a NSW-NSO Physical Screening Test (PST)
kentuckyblue
US Navy 070821-N-8923M-006 Nimitz-class aircraft carrier USS Harry S. Truman (CVN 75) conducts a test fire of the rolling airframe missile system (RAM). RAM uses missiles to shoot down incoming enemy aircraft
aboard uss harry s. truman (cvn-75)ship
Symbol LED
svg simplified symbols-electricitypd-user
Bloodstream cardiology coronary disease
medicinehealth
Portrait people clothing
clothinggirl
PK TS Lev tram test vehicle 2019 2
vehicletraffic
US Navy 050425-N-7676W-024 Sgt. 1st Class James Burcham assigned to the 16th Ordinance Battalion tests new flexible arm and leg protective armor
marylandaberdeen
US Navy 100829-N-0864H-900 Gunner's Mate 1st Class James Carter and Gunner's Mate 3rd Class Chad Thomes test fire a 40mm saluting battery aboard the U.S. 7th Fleet command ship USS Blue Ridge (LCC 19)
gunner's matesea
Kyoto Subway unit 11A West Takeda
vehiclecar
US Navy 070611-N-7676W-097 The Midsize Automated Research Vehicle (MARV) is hoisted aboard Project Support Craft (PSC) 12 following pierside testing during Autonomous Underwater Vehicle (AUV) Fest 2007, hosted by the Naval Surf
boatship
US Navy 100526-N-7280V-023 Fire Controlman 3rd Class Patrick Ramos and Gunner's Mate 2nd Class Joshua Pacheco test fire a 40mm saluting battery in preparation for the U.S. 7th Fleet change of command ceremony
change of command ceremonies of the united states navyaboard uss blue ridge (lcc-19)
US Navy 070905-N-8704K-061 U.S. Navy Cmdr. Anna Stalcup, attached to Military Sealift Command hospital ship USNS Comfort (T-AH 20), performs optometry tests for a patient with the help of a Creole translator at Hôpital Universitaire
2007 in port-au-princeport-au-prince
Esa test
files with no machine-readable sourceself-published work
Petri
sciencewater
Bug
medicinescience
Services rating satisfaction hand
businessgold
Conical flask
laboratorystencil
Test-SVG2
self-published worksuperseded
Test Tubes
researchhuman
X-47B receives fuel from an Omega K-707 tanker while operating in the Atlantic Test Ranges
aircraftvehicle
US Navy 060218-N-4772B-030 Damage Controlman Fireman Nicholas Koslowski and Damage Controlman 3rd Class Charles Andrews test a P-100 portable pump aboard the amphibious dock, landing ship USS Harpers Ferry (LSD 49)
aboard uss harpers ferry (lsd-49)damage controlman
US Navy 090609-N-3610L-618 Midshipman Kaitlyn Hackel tests the weight of an Enhanced Battle Rifle (EBR) during an Explosive Ordnance Disposal (EOD) Technician demonstration in the hangar bay of the aircraft carrier USS Ronald R
hangar bays of uss ronald reagan (cvn-76)military
Climbing forest forest high
climbingforest
Climbing forest forest high
climbingforest
A U.S. Marine Corps MV-22 Osprey tiltrotor aircraft attached to Marine Operational Test and Evaluation Squadron (VMX) 22 prepares to land on the amphibious assault ship USS America (LHA 6) in the Pacific Ocean 140827-N-MD297-063
militaryvehicle
US Navy 070116-N-7676W-021 Andrew Wyman, center, range test engineer at the Naval Surface Warfare Center, Dahlgren Division (NSWCDD), explains the impact from the Electromagnetic Railgun (EMRG) to Rear Adm. William E. Landay, C
naval surface warfare center dahlgren divisionrailguns
US Navy 071030-N-4133B-064 Damage Controlman Fireman Ryan Anderson hands a sample of aqueous film forming foam (AFFF) to Damage Controlman 2nd Class William Koziol aboard Nimitz-class aircraft carrier USS Ronald Reagan (CVN 76)
aqueous film forming foamdamage controlman
US Navy 100415-N-6138K-591 Chief Hospital Corpsman Carl Holzhauer, right, assigned to the amphibious dock landing ship USS Gunston Hall (LSD 44), talks to Senegal army Sgt. Sidy Niang as he tests an intravenous catheter
aboard uss gunston hall (lsd-44)tactical combat casualty care
Medical medicine experiment
medicinescience
US Navy 071106-N-0000X-001 A Standard Missile-3 (SM-3) is launched from Pearl Harbor-based guided-missile cruiser USS Lake Erie (CG 70) to intercept a threat representative target as part of a Missile Defense Agency test of the
launches of rim-161 standard sm-3missile launches by night
US Navy 090611-N-5242D-248 Djiboutian Navy Cpl. Abdoullauder Issa tests a full fire-fighting ensemble and MCU-2P gas mask after receiving damage control familiarization training
aboard uss arleigh burke (ddg-51)people
US Navy 100122-N-8907D-197 Aviation Boatswain's Mate (Equipment) Timothy Miller signals conditions ready during testing of the catapult system aboard the Nimitz-class aircraft carrier USS Harry S. Truman (CVN 75)
aboard uss harry s. truman (cvn-75)equipment
A U.S. Marine Corps MV-22 Osprey tiltrotor aircraft attached to Marine Operational Test and Evaluation Squadron (VMX) 22 prepares to land on the amphibious assault ship USS America (LHA 6) in the Pacific Ocean 140827-N-MD297-087
militaryvehicle
NASA’s Freedom Star boat sets out for a day of testing after departing from port near Cape Canaveral Air Force Station in Florida for the Atlantic Ocean with NASA’s Mobile Aerospace Reconnaissance Sys
animalsbird
Faridun tests his sons, Āqā Mīrak
shah tahmasp's shahnameh in the aga khan museumaqa mirak
Bug
medicinescience
Fever heart heart attack
medicinehealth
Monk Testing Wine, Antonio Salvador Casanova y Estorach, circa 1886
19th-century paintings in the brooklyn museumantonio casanova y estorach
Cure electrocardiogram health care
medicinehealth
US Navy 060225-N-7130B-096 Aviation Warfare Systems Operator 2nd Class Kris Kopy prepares to test fire a .50 caliber aircraft machine gun from a HH-60H Seahawk helicopter
browning m2 on aircrafthh-60h rescue hawk
US Navy 050803-N-0295M-078 Flight Instructor, U.S. Marine Corps Maj. Michael Dehner, right, points out an item on the preflight checklist to student, Navy Lt. Christopher Dotson, prior to a flight from Naval Air Station Patuxen
christopher d. dotsonpeople
US Navy 091010-N-0807W-002 Chief Warrant Officer 3 Donald Kisihmoto, assigned to Assault Craft Unit 5, tests his compass aboard the amphibious dock landing ship USS Harpers Ferry (LSD 49)
magnetic compasspeople
Test Tubes
researchhuman
I.Q. Test (NBY 5985), 1942
fort benjamin harrisonintelligence tests
US Navy 090128-N-3666S-022 Gas Turbine System Technician 3rd Class Clayton Kraus tests a manual valve hydraulic control station aboard the Ticonderoga-class guided-missile cruiser USS Chosin (CG 65)
celebritiesred
US Navy 100712-N-3749M-001 Capt. John Polowczyk, commanding officer of the Fleet and Industrial Supply Center Pearl Harbor, prepares to take the new conventional hybrid vehicle for a test drive
vehiclecar
Flask
scienceglass
US President JF Kennedy inspects Bermuda Rifles 1961
riflemanarmy
US Navy 050616-N-1467R-014 An MV-22 Osprey conducts a tactical landing at Raven Landing Zone on board Camp Lejeune Marine Base
militaryvehicle
Moscow tram 3365 2004-02 Novogireevo test ride 2
tatra t3vehicle
Clinic offering 10000 JPY covid-19 antibody testing and same price Vitamin C
ascorbic acidletter
Survey customer poll
businesssymbol
Eyelash vision optometry
medicinehealth
Test chart pattern
test patterncolor bars
U.S. Navy Machinist's Mate 2nd Class Stephanie Faenza performs an odor test on liquid oxygen Jan. 12, 2014, aboard the aircraft carrier USS Harry S. Truman (CVN 75) in the Persian Gulf 140112-N-ZG705-006
operation enduring freedompeople
US Navy 070129-N-7367K-004 Builder Constructionman Douglas Norris, left, a Seabee assigned to Naval Mobile Construction Battalion One (NMCB-1), is one of the first students in the Medium Girder Bridge Course to test the bridge
builder (united states navy)mississippi
US Navy 030726-N-0696M-007 Lt. Benjamin VanBuskirk gives the signal to launch an F-A-18 Hornet
militaryvehicle
Moscow tram 3365 2004-02 Novogireevo test ride
self-published workvehicle
Cardiology device electrocardiogram
medicinehealth
Medical health symbol
symbolmaps
The Fingernail Test, Peter Franchoys
southern netherlandish paintings in the royal museums of fine arts of belgiumflemish baroque painting
Check list
testexam
US Navy 030725-N-0696M-022 Airman Dylan Wondra directs aircraft on the flight deck, while an F-A-18F Super Hornet makes an arrested landing on the flight deck aboard USS Ronald Reagan (CVN 76)
aircraftvehicle
A juvenile Whooping Crane tests its wings shortly after being released from a holding pen on Wheeler National Wildlife Refuge. Photo by Bill Gates, USFWS Feb. 10, 2012
animalsbird
US Navy 091022-N-0890S-174 Operations Specialist Seaman David Mccatty tests his pipe patching skills during a general quarters drill aboard the multipurpose amphibious assault ship USS Wasp (LHD 1)
united states navy images from the caribbean seaoperations specialist (united states navy)
A-7E A-4M A-6E AV-8C over NAS China Lake 1981
militaryvehicle
La Teste-de-Buch - bourg 6
postcards published by gaby bessièrespostcards of la teste-de-buch
Ecg electrocardiogram medical
healthbody
La Teste-de-Buch.Rue du Port, between 1900 and 1910
postcards of la teste-de-buchstreets in la teste-de-buch
Chemistry
scienceglass
Climbing forest forest high
climbingforest
US Navy 030725-N-0696M-096 An F-A-18F Super Hornet launches from one of four steam driven catapults on the flight deck aboard USS Ronald Reagan (CVN 76)
vehiclenavy
US Navy 071029-N-5961C-001 After being in the shipyard for six months, USS Ronald Reagan (CVN 76) heads out to sea for a shakedown period
skylinevehicle
Drugs heart heart attack
medicinehealth
Drupe fruit diagram
sciencefruits
US Navy 080919-N-1635S-005 An aviation electronics technician performs maintenance checks prior to an engine test run on an EA-6B Prowler assigned to the
militaryvehicle
F-14D VX-4, 2 x F-16C 169 FW, 2 x F-15C 159 FW Cope Snapper (021018-F-XC395-014)
aircraftvehicle
US Navy 030725-N-0696M-048 An F-A-18F Super Hornet makes an arrested landing on the flight deck aboard USS Ronald Reagan (CVN 76)
militaryvehicle
Fruit wine white
berriesfood
Naval Air Test Center Douglas A-4E Skyhawk at Patuxent River in August 1967
militaryvehicle
3301 - 3400 of 7,399 Next page
/ 74